제품 > 항체 > 다중클론항체(pAb)

AVEN Rabbit pAb (A12910)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using AVEN Rabbit pAb (A12910) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	AVEN Rabbit pAb
Catalog No.	A12910
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in negative regulation of apoptotic process. Located in membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 203-362 of human AVEN (NP_065104.1).
Sequence	VQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSMIS
Gene ID
Swiss Prot
Synonyms	PDCD12; AVEN
Calculated MW	39kDa
Observed MW	55kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:3000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	22RV1, HT-29, LO2, HeLa
Cellular location	Endomembrane system, Peripheral membrane protein
Customer validation	WB(Homo sapiens)