제품 > 항체 > 다중클론항체(pAb)

AVPR1A Rabbit pAb (A8400)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using AVPR1A antibody (A8400) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunofluorescence - AVPR1A Rabbit pAb (A8400)

Immunofluorescence analysis of C6 cells using AVPR1A Rabbit pAb (A8400) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using AVPR1A Rabbit pAb (A8400) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	AVPR1A Rabbit pAb
Catalog No.	A8400
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction and proliferation, platelet aggregation, release of coagulation factor and glycogenolysis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 349-418 of human AVPR1A (NP_000697.1).
Sequence	MFFSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
Gene ID
Swiss Prot
Synonyms	V1aR; AVPR1; AVPR V1a
Calculated MW	47kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HepG2, A-549, Mouse liver, Rat liver
Cellular location	Cell membrane, Multi-pass membrane protein