제품 > 항체 > 다중클론항체(pAb)

Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb (A12481)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Alpha-1 Antitrypsin (Alpha-1 Antitrypsin (SERPINA1)) antibody (A12481) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb (A12481)

Immunofluorescence analysis of PC-12 cells using Alpha-1 Antitrypsin (Alpha-1 Antitrypsin (SERPINA1)) antibody (A12481) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb
Catalog No.	A12481
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 25-315 of human Alpha-1 Antitrypsin (Alpha-1 Antitrypsin (SERPINA1)) (NP_000286.3).
Sequence	EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKL
Gene ID
Swiss Prot
Synonyms	PI; A1A; AAT; PI1; A1AT; nNIF; PRO2275; alpha1AT
Calculated MW	47kDa
Observed MW	45kDa, 50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	SW480, HT-29, Mouse lung
Cellular location	Endoplasmic reticulum, Secreted, extracellular matrix, extracellular space
Customer validation	WB(Other)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb images

Western blot - Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb (A12481)

Immunofluorescence - Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb (A12481)

Immunofluorescence analysis of PC-12 cells using Alpha-1 Antitrypsin (Alpha-1 Antitrypsin (SERPINA1)) antibody (A12481) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.