제품 > 항체 > 다중클론항체(pAb)

Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb (A1015)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb (A1015) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb (A1015)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb (A1015) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb (A1015)

Immunofluorescence analysis of HepG2 cells using Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb (A1015) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb
Catalog No.	A1015
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 156-255 of human Alpha-1 Antitrypsin (SERPINA1) (NP_000286.3).
Sequence	EDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQH
Gene ID
Swiss Prot
Synonyms	PI; A1A; AAT; PI1; A1AT; nNIF; PRO2275; alpha1AT; Alpha-1 Antitrypsin (SERPINA1)
Calculated MW	47kDa
Observed MW	51kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HepG2, 293T, Mouse lung
Cellular location	Endoplasmic reticulum, Secreted, extracellular matrix, extracellular space
Customer validation	WB(Homo sapiens, Mus musculus)