Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Alpha Internexin Rabbit mAb (A3596) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of Alpha Internexin in paraffin-embedded human colon tissue using Alpha Internexin Rabbit mAb (A3596) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of Alpha Internexin in paraffin-embedded rat brain tissue using Alpha Internexin Rabbit mAb (A3596) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of Alpha Internexin in paraffin-embedded human brain tissue using Alpha Internexin Rabbit mAb (A3596) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of Alpha Internexin in paraffin-embedded human appendix tissue using Alpha Internexin Rabbit mAb (A3596) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of Alpha Internexin in paraffin-embedded mouse brain tissue using Alpha Internexin Rabbit mAb (A3596) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded rat brain using Alpha Internexin Rabbit mAb (A3596) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | Alpha Internexin Rabbit mAb |
|---|---|
| Catalog No. | A3596 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC2054 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Alpha Internexin (Q16352). |
|---|---|
| Sequence | EVAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEE |
| Gene ID | |
| Swiss Prot | |
| Synonyms | NEF5; NF66; NF-66; TXBP-1; Alpha Internexin |
| Calculated MW | 55kDa |
| Observed MW | 62-67kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | U-87MG, Mouse brain, Rat brain |
| Cellular location | cytoplasm, cytoplasmic ribonucleoprotein granule, extracellular space, neurofilament, postsynaptic intermediate filament cytoskeleton, Schaffer collateral - CA1 synapse |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
