제품 > 항체 > 다중클론항체(pAb)

Aquaporin-1 (AQP1) Rabbit pAb (A15030)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Aquaporin-1 (AQP1) Rabbit pAb (A15030) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - Aquaporin-1 (AQP1) Rabbit pAb (A15030)

Immunohistochemistry analysis of paraffin-embedded human kidney using Aquaporin-1 (AQP1) Rabbit pAb (A15030) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse kidney using Aquaporin-1 (AQP1) Rabbit pAb (A15030) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat kidney using Aquaporin-1 (AQP1) Rabbit pAb (A15030) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Aquaporin-1 (AQP1) Rabbit pAb (A15030)

Immunofluorescence analysis of paraffin-embedded rat kidney using Aquaporin-1 (AQP1) Rabbit pAb (A15030) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded human kidney using Aquaporin-1 (AQP1) Rabbit pAb (A15030) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Aquaporin-1 (AQP1) Rabbit pAb
Catalog No.	A15030
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a small integral membrane protein with six bilayer spanning domains that functions as a water channel protein. This protein permits passive transport of water along an osmotic gradient. This gene is a possible candidate for disorders involving imbalance in ocular fluid movement.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-269 of human Aquaporin-1 (AQP1) (NP_932766.1).
Sequence	AVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
Gene ID
Swiss Prot
Synonyms	CO; CHIP28; AQP-CHIP; Aquaporin-1 (AQP1)
Calculated MW	29kDa
Observed MW	25kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse liver, Mouse heart, Rat lung
Cellular location	Cell membrane, Multi-pass membrane protein
Customer validation	IHC(Mus musculus, Rattus norvegicus, Scophthalmus maximus) WB(Gallus gallus, Rattus norvegicus) IF(Rattus norvegicus) IHC(Rattus norvegicus)