제품 > 항체 > 단일클론항체(mAb)

Aquaporin-4 (AQP4) Rabbit mAb (A11210)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using Aquaporin-4 (AQP4) Rabbit mAb (A11210) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - Aquaporin-4 (AQP4) Rabbit mAb (A11210)

Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Aquaporin-4 (AQP4) Rabbit mAb (A11210) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Aquaporin-4 (AQP4) Rabbit mAb (A11210) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Aquaporin-4 (AQP4) Rabbit mAb (A11210) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Aquaporin-4 (AQP4) Rabbit mAb (A11210) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using Aquaporin-4 (AQP4) Rabbit mAb (A11210) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Aquaporin-4 (AQP4) Rabbit mAb (A11210) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using Aquaporin-4 (AQP4) Rabbit mAb (A11210) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Aquaporin-4 (AQP4) Rabbit mAb (A11210)

Confocal imaging of paraffin-embedded mouse brain tissue using Aquaporin-4 (AQP4) Rabbit mAb (A11210, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform microwave antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Confocal imaging of paraffin-embedded rat brain tissue using Aquaporin-4 (AQP4) Rabbit mAb (A11210, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform microwave antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	Aquaporin-4 (AQP4) Rabbit mAb
Catalog No.	A11210
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54345

Background

This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. This protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Additional isoforms, resulting from the use of alternative in-frame translation initiation codons, have also been described. Recent studies provided evidence for translational readthrough in this gene, and expression of C-terminally extended isoforms via the use of an alternative in-frame translation termination codon.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 256-323 of human Aquaporin-4 (AQP4) (NP_001641.1).
Sequence	VEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Gene ID
Swiss Prot
Synonyms	MIWC; WCH4; hAQP4; Aquaporin-4 (AQP4)
Calculated MW	32KDa/34kDa
Observed MW	35kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:200 - 1:800 IF/ICC 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	SKOV3, Mouse brain, Rat brain
Cellular location	Membrane, Multi-pass membrane protein.
Customer validation	IHC(Homo sapiens) WB(Rattus norvegicus) IF(Cavia porcellus)