Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Aquaporin-4 (AQP4) Rabbit pAb |
---|---|
Catalog No. | A2887 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 256-323 of human Aquaporin-4 (AQP4) (NP_001641.1). |
---|---|
Sequence | VEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV |
Gene ID | |
Swiss Prot | |
Synonyms | MIWC; WCH4; hAQP4; Aquaporin-4 (AQP4) |
Calculated MW | 35kDa |
Observed MW | 35kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | SKOV3 |
Cellular location | Membrane, Multi-pass membrane protein. |
Customer validation | WB(Rattus norvegicus, Homo sapiens, Gallus gallus, Mus musculus) IF(Mus musculus) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2887? Please let us know so that we can cite the reference in this datasheet.