제품 > 항체 > 단일클론항체(mAb)

Arp2 Rabbit mAb (A8876)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Arp2 Rabbit mAb (A8876) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunoprecipitation - Arp2 Rabbit mAb (A8876)

Immunoprecipitation analysis of 300 μg extracts of C6 cells using 3 μg Arp2 antibody (A8876). Western blot was performed from the immunoprecipitate using Arp2 antibody (A8876) at a dilution of 1:1000.

Overview

Product name	Arp2 Rabbit mAb
Catalog No.	A8876
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1336

Background

The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 295-394 of human Arp2 (P61160).
Sequence	SEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
Gene ID
Swiss Prot
Synonyms	ARP2; Arp2
Calculated MW	45kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, HepG2, MCF7, NIH/3T3, C6, Mouse brain, Mouse thymus, Rat spleen, Rat kidney
Cellular location	Cell projection, Cytoplasm, Cytoskeleton