제품 > 항체 > 단일클론항체(mAb)

Arp3 Rabbit mAb (A4514)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Arp3 Rabbit mAb (A4514) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - Arp3 Rabbit mAb (A4514)

Immunohistochemistry analysis of Arp3 in paraffin-embedded human colon carcinoma tissue using Arp3 Rabbit mAb (A4514) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Arp3 in paraffin-embedded human tonsil tissue using Arp3 Rabbit mAb (A4514) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Arp3 in paraffin-embedded mouse spleen tissue using Arp3 Rabbit mAb (A4514) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Arp3 in paraffin-embedded rat brain tissue using Arp3 Rabbit mAb (A4514) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Arp3 Rabbit mAb (A4514)

Immunofluorescence analysis of C6 cells using Arp3 Rabbit mAb (A4514) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Confocal imaging of U-2 OS cells using Arp3 Rabbit mAb (A4514, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	Arp3 Rabbit mAb
Catalog No.	A4514
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1067

Background

The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. Three transcript variants encoding two different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 319-418 of human Arp3 (P61158).
Sequence	IVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Gene ID
Swiss Prot
Synonyms	ARP3
Calculated MW	47kDa
Observed MW	47kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HepG2, Jurkat, U-251MG, Mouse lung, Mouse liver, Mouse spleen, Rat lung, Rat brain, Rat spleen
Cellular location	Cell projection, Cytoplasm, cytoskeleton
Customer validation	WB(Homo sapiens)