Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | BAF250 Rabbit pAb |
---|---|
Catalog No. | A16648 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1300-1400 of mouse BAF250 (NP_001074288.1). |
---|---|
Sequence | NMGTGAPQPNLMPSTPDSGMYSPSRYPPQQQQQQQQQHDSYGNQFSTQGTPSSSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSAGQGQ |
Gene ID | |
Swiss Prot | |
Synonyms | Osa1; BAF250; BAF250a; Smarcf1; 1110030E03Rik |
Calculated MW | 242kDa |
Observed MW | 260kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-87MG, Mouse testis |
Cellular location | Nucleus |
Customer validation | WB(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16648? Please let us know so that we can cite the reference in this datasheet.