Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using BCAS2 Rabbit pAb (A4398) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded rat kidney using BCAS2 Rabbit pAb (A4398) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using BCAS2 Rabbit pAb (A4398) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using BCAS2 Rabbit pAb (A4398) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Product name | BCAS2 Rabbit pAb |
|---|---|
| Catalog No. | A4398 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human BCAS2 (NP_005863.1). |
|---|---|
| Sequence | MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF |
| Gene ID | |
| Swiss Prot | |
| Synonyms | DAM1; SPF27; Snt309; BCAS2 |
| Calculated MW | 26kDa |
| Observed MW | 25kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | 293T, Jurkat, MCF-7, HeLa, SKOV3, Mouse testis, Mouse spleen, Mouse lung, Rat lung |
| Cellular location | Nucleus, nucleolus |
| Customer validation | IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4398? Please let us know so that we can cite the reference in this datasheet.
_IHC_01.jpg?t=1715051281 "ABclonal:Immunohistochemistry - BCAS2 Rabbit pAb (A4398)")
_IHC_02.jpg?t=1715051281 "ABclonal:Immunohistochemistry - BCAS2 Rabbit pAb (A4398)")
_IHC_03.jpg?t=1715051281 "ABclonal:Immunohistochemistry - BCAS2 Rabbit pAb (A4398)")
_IF_01.jpg?t=1715051281 "ABclonal:Immunofluorescence - BCAS2 Rabbit pAb (A4398)")
