제품 > 항체 > 다중클론항체(pAb)

BDKRB2 Rabbit pAb (A2844)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using BDKRB2 antibody (A2844) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunofluorescence - BDKRB2 Rabbit pAb (A2844)

Immunofluorescence analysis of HeLa cells using BDKRB2 Rabbit pAb (A2844) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using BDKRB2 Rabbit pAb (A2844) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	BDKRB2 Rabbit pAb
Catalog No.	A2844
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. Bradykinin is released upon activation by pathophysiologic conditions such as trauma and inflammation, and binds to its kinin receptors, B1 and B2. The B2 receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 302-391 of human BDKRB2 (NP_000614.1).
Sequence	SSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ
Gene ID
Swiss Prot
Synonyms	B2R; BK2; BK-2; BKR2; BRB2
Calculated MW	44kDa
Observed MW	44kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A-549, MCF7, Mouse liver, Rat liver
Cellular location	Cell membrane, Multi-pass membrane protein
Customer validation	WB(Mus musculus)