제품 > 항체 > 다중클론항체(pAb)

BET1L Rabbit pAb (A11951)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using BET1L Rabbit pAb (A11951) at 1:3000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.

Overview

Product name	BET1L Rabbit pAb
Catalog No.	A11951
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables SNAP receptor activity. Involved in regulation of retrograde vesicle-mediated transport, Golgi to ER and retrograde transport, endosome to Golgi. Located in Golgi apparatus and endosome. Implicated in uterine fibroid. Biomarker of endometrial adenocarcinoma.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human BET1L (NP_057610.2).
Sequence	MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAH
Gene ID
Swiss Prot
Synonyms	GS15; BET1L1; GOLIM3; HSPC197; BET1L
Calculated MW	12kDa
Observed MW	14kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, Jurkat, K-562
Cellular location	Golgi apparatus, Golgi apparatus membrane, Single-pass type IV membrane protein, trans-Golgi network membrane
Customer validation	WB(Homo sapiens) IHC(Homo sapiens)