제품 > 항체 > 다중클론항체(pAb)

BOB1 Rabbit pAb (A24457)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of Daudi, using BOB1 Rabbit pAb (A24457) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	BOB1 Rabbit pAb
Catalog No.	A24457
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human BOB1(NP_006226.2).
Sequence	NVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHT
Gene ID
Swiss Prot
Synonyms	POU2AF1; BOB1; OBF-1; OBF1; OCAB; POU class 2 associating factor 1
Calculated MW	27kDa
Observed MW	37kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Daudi
Cellular location	Nucleus