제품 > 항체 > 다중클론항체(pAb)

BRCC2/BLID Rabbit pAb (A7275)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with BRCC2/BLID, using BRCC2/BLID Rabbit pAb (A7275) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - BRCC2/BLID Rabbit pAb (A7275)

Immunofluorescence analysis of MCF-7 cells using BRCC2/BLID Rabbit pAb (A7275). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	BRCC2/BLID Rabbit pAb
Catalog No.	A7275
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a BH3-like motif containing protein involved in cell death. The encoded protein may induce apoptosis in a caspase-dependent manner. The protein is localized in both the cytoplasm and the mitochondrion.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human BRCC2/BLID (NP_001001786.2).
Sequence	MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
Gene ID
Swiss Prot
Synonyms	BRCC2; BRCC2/BLID
Calculated MW	12kDa
Observed MW	16kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:100 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T transfected with BRCC2/BLID
Cellular location	Cytoplasm, Mitochondrion.