제품 > 항체 > 다중클론항체(pAb)

BRSK2 Rabbit pAb (A17042)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using BRSK2 Rabbit pAb (A17042) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	BRSK2 Rabbit pAb
Catalog No.	A17042
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including ATP binding activity; ATPase binding activity; and protein kinase activity. Involved in several processes, including cellular protein metabolic process; intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress; and regulation of insulin secretion involved in cellular response to glucose stimulus. Located in centrosome and endoplasmic reticulum.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human BRSK2 (NP_001243556.1).
Sequence	WSCGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFIPPDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPEPEQPIPRKVQIRSLPSLEDIDP
Gene ID
Swiss Prot
Synonyms	SAD1; SADA; SAD-A; STK29; PEN11B; C11orf7; BRSK2
Calculated MW	82kDa
Observed MW	78-90kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, A-549, Mouse brain
Cellular location	centrosome, cytoplasm, endoplasmic reticulum, perinuclear region of cytoplasm