BSN Rabbit pAb (A20464)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

ABclonal:Immunofluorescence - BSN Rabbit pAb (A20464)

Immunofluorescence analysis of Neuro-2a cells using BSN Rabbit pAb (A20464) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of SH-SY5Y cells using BSN Rabbit pAb (A20464) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	BSN Rabbit pAb
Catalog No.	A20464
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Neurotransmitters are released from a specific site in the axon terminal called the active zone, which is composed of synaptic vesicles and a meshwork of cytoskeleton underlying the plasma membrane. The protein encoded by this gene is thought to be a scaffolding protein involved in organizing the presynaptic cytoskeleton. The gene is expressed primarily in neurons in the brain. A similar gene product in rodents is concentrated in the active zone of axon terminals and tightly associated with cytoskeletal structures, and is essential for regulating neurotransmitter release from a subset of synapses.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 830-950 of human BSN (NP_003449.2).
Sequence	PPARAAELTDEDFMRRQILEMSAEEDNLEEDDTATSGRGLAKHGTQKGGPRPRPEPSQEPAALPKRRLPHNATTGYEELLPEGGSAEATDGSGTLQGGLRRFKTIELNSTGSYGHELDLGQ
Gene ID
Swiss Prot
Synonyms	ZNF231
Calculated MW	416kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples
Cellular location	axon, cochlear hair cell ribbon synapse, cytoskeleton of presynaptic active zone, dendrite, excitatory synapse, GABA-ergic synapse, glutamatergic synapse, neuron projection terminus, nucleus, postsynaptic density, presynaptic active zone, Schaffer collateral - CA1 synapse, synaptic vesicle, synaptic vesicle membrane