Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Arabidopsis thaliana
Product name | BSU1 Rabbit pAb |
---|---|
Catalog No. | A21273 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 694-793 of arabidopsis thaliana BSU1 (NP_171844.6). |
---|---|
Sequence | FLERNGLEMILRAHECVIDGFERFADGRLITVFSATNYCGTAQNAGAILVIGRDMVIYPKLIHPHPPPISSSEEDYTDKAWMQELNIEMPPTPARGESSE |
Gene ID | |
Swiss Prot | |
Synonyms | BRI1 SUPPRESSOR 1; F21B7.7; BSU1 |
Calculated MW | 88kDa |
Observed MW | 88kDa |
Reactivity | Arabidopsis thaliana |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Seedling, Inflorescences, Before inflorescence |
Cellular location | cytoplasm, nucleus, plasma membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.