Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | Bcl-2(Isoform Beta) Rabbit pAb |
---|---|
Catalog No. | A18415 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-199 of mouse Bcl2(Isoform Beta) (NP_803129.2). |
---|---|
Sequence | FGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGACLVE |
Gene ID | |
Swiss Prot | |
Synonyms | Bcl-2; C430015F12Rik; D630044D05Rik; D830018M01Rik; Bcl2(Isoform Beta) |
Calculated MW | 26kDa |
Observed MW | 22kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Rat liver |
Cellular location | cytoplasm, cytosol, endoplasmic reticulum, mitochondrial crista, mitochondrial membrane, mitochondrial outer membrane, mitochondrion, nuclear membrane, nucleoplasm, nucleus, perinuclear region of cytoplasm |
Customer validation | WB(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A18415? Please let us know so that we can cite the reference in this datasheet.