제품 > 항체 > 단일클론항체(mAb)

Bcl-2 Rabbit mAb (A25812)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using BCL2 Rabbit mAb (A25812) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Bcl-2 Rabbit mAb (A25812)

Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using BCL2 Rabbit mAb (A25812) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	Bcl-2 Rabbit mAb
Catalog No.	A25812
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67750

Background

Enables BH domain binding activity. Involved in several processes, including response to peptide; response to purine-containing compound; and response to vitamin. Located in cytosol; mitochondrial crista; and perinuclear region of cytoplasm. Used to study several diseases, including brain ischemia (multiple); end stage renal disease; gastric ulcer; intestinal disease (multiple); and status epilepticus. Biomarker of several diseases, including abdominal obesity-metabolic syndrome 1; brain disease (multiple); hypertension (multiple); intrinsic cardiomyopathy (multiple); and neurodegenerative disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including carcinoma (multiple); hematologic cancer (multiple); intracranial aneurysm; prostate cancer; and urinary bladder cancer. Orthologous to human BCL2 (BCL2 apoptosis regulator).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of rat Bcl2 (NP_058689.2).
Sequence	MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDD
Gene ID
Swiss Prot
Synonyms	Bcl-2
Calculated MW	26kDa
Observed MW	26kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IHC-P 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	C6, Rat lung
Cellular location	Mitochondrion outer membrane. Nucleus membrane. Endoplasmic reticulum membrane.
Customer validation	WB(Mus musculus)