제품 > 항체 > 다중클론항체(pAb)

Bcl-2 Rabbit pAb (A25052)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from Mouse spleen using Bcl2 Rabbit pAb(A25052) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Immunoprecipitation - Bcl-2 Rabbit pAb (A25052)

Immunoprecipitation of Bcl2 in 300 µg extracts from mouse lung using 3 µg Bcl2 Rabbit pAb (A25052). Western blot analysis was performed using Bcl2 Rabbit pAb (A25052) at 1:500 dilution.

Overview

Product name	Bcl-2 Rabbit pAb
Catalog No.	A25052
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables BH domain binding activity. Involved in several processes, including response to peptide; response to purine-containing compound; and response to vitamin. Located in cytosol; mitochondrial crista; and perinuclear region of cytoplasm. Used to study several diseases, including brain ischemia (multiple); end stage renal disease; gastric ulcer; intestinal disease (multiple); and status epilepticus. Biomarker of several diseases, including abdominal obesity-metabolic syndrome 1; brain disease (multiple); hypertension (multiple); intrinsic cardiomyopathy (multiple); and neurodegenerative disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including carcinoma (multiple); hematologic cancer (multiple); intracranial aneurysm; prostate cancer; and urinary bladder cancer. Orthologous to human BCL2 (BCL2 apoptosis regulator).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of rat Bcl2(NP_058689.2).
Sequence	MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDD
Gene ID
Swiss Prot
Synonyms	Bcl-2;
Calculated MW	26kDa
Observed MW	26kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	Mouse spleen, Mouse lung
Cellular location	Mitochondrion outer membrane. Nucleus membrane. Endoplasmic reticulum membrane.
Customer validation	WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Bcl-2 Rabbit pAb images

Western blot - Bcl-2 Rabbit pAb (A25052)

Immunoprecipitation - Bcl-2 Rabbit pAb (A25052)

Immunoprecipitation of Bcl2 in 300 µg extracts from mouse lung using 3 µg Bcl2 Rabbit pAb (A25052). Western blot analysis was performed using Bcl2 Rabbit pAb (A25052) at 1:500 dilution.

* For research use only. Not for therapeutic or diagnostic purposes.