제품 > 항체 > 다중클론항체(pAb)

Bmi1 Rabbit pAb (A0211)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Bmi1 Rabbit pAb (A0211) at 1:5000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunoprecipitation - Bmi1 Rabbit pAb (A0211)

Immunoprecipitation analysis of 200 μg extracts of K-562 cells, using 3 μg Bmi1 antibody (A0211). Western blot was performed from the immunoprecipitate using Bmi1 antibody (A0211) at a dilution of 1:1000.

Review

Overview

Product name	Bmi1 Rabbit pAb
Catalog No.	A0211
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1). This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Bmi1 (NP_005171.4).
Sequence	LKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP
Gene ID
Swiss Prot
Synonyms	PCGF4; RNF51; FLVI2/BMI1; flvi-2/bmi-1; Bmi1
Calculated MW	37kDa
Observed MW	43kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, A-549, K-562, Mouse heart, Mouse thymus, Rat thymus, Rat testis
Cellular location	Cytoplasm, Nucleus.
Customer validation	(NCI-N87 cells) WB(Homo sapiens) ChIP(Homo sapiens)