제품 > 항체 > 단일클론항체(mAb)

Butyrylcholinesterase Rabbit mAb (A8861)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of HeLa cells, using Butyrylcholinesterase antibody (A8861) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	Butyrylcholinesterase Rabbit mAb
Catalog No.	A8861
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1328

Background

This gene encodes a cholinesterase enzyme and member of the type-B carboxylesterase/lipase family of proteins. The encoded enzyme exhibits broad substrate specificity and is involved in the detoxification of poisons including organophosphate nerve agents and pesticides, and the metabolism of drugs including cocaine, heroin and aspirin. Humans homozygous for certain mutations in this gene exhibit prolonged apnea after administration of the muscle relaxant succinylcholine.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 500-602 of human Butyrylcholinesterase (P06276).
Sequence	ANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL
Gene ID
Swiss Prot
Synonyms	E1; CHE1; CHE2; BCHED
Calculated MW	68kDa
Observed MW	90kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa
Cellular location	blood microparticle, endoplasmic reticulum lumen, extracellular region, extracellular space, nuclear envelope lumen, plasma membrane