제품 > 항체 > 다중클론항체(pAb)

C1orf146 Rabbit pAb (A18804)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of lysates from Rat testis, using C1orf146 Rabbit pAb (A18804) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - C1orf146 Rabbit pAb (A18804)

Immunofluorescence analysis of paraffin-embedded rat testis using C1orf146 Rabbit pAb (A18804) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded Mouse testis using C1orf146 Rabbit pAb (A18804) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded mouse testis using C1orf146 Rabbit pAb (A18804) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	C1orf146 Rabbit pAb
Catalog No.	A18804
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in reciprocal meiotic recombination and synaptonemal complex assembly. Located in chromosome. Is expressed in ovary; spermatid; spermatocyte; spermatogonium; and testis. Orthologous to human C1orf146 (chromosome 1 open reading frame 146).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 47-173 of mouse C1orf146 (NP_877422.2).
Sequence	GSIVFSLSGVAFLLMDAKECMTSAEEIFVTKIEKFINIHQNSFLVLFAPLHGPEEWSLMFRIHQRFLGSNLRILPVHNTVNALDLMCTIAKTTSKPHIDSICYRMITTKAYIIEQSPVWRTLQKIKL
Gene ID
Swiss Prot
Synonyms	SCRE; Spo16; C1orf146
Calculated MW	21kDa
Observed MW	20kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Rat testis
Cellular location