Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | C1orf146 Rabbit pAb |
---|---|
Catalog No. | A18804 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 47-173 of mouse C1orf146 (NP_877422.2). |
---|---|
Sequence | GSIVFSLSGVAFLLMDAKECMTSAEEIFVTKIEKFINIHQNSFLVLFAPLHGPEEWSLMFRIHQRFLGSNLRILPVHNTVNALDLMCTIAKTTSKPHIDSICYRMITTKAYIIEQSPVWRTLQKIKL |
Gene ID | |
Swiss Prot | |
Synonyms | SCRE; Spo16; C1orf146 |
Calculated MW | 21kDa |
Observed MW | 20kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Rat testis |
Cellular location |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.