제품 > 항체 > 다중클론항체(pAb)

C1qa Rabbit pAb (A24519)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using C1qa Rabbit pAb (A24519) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - C1qa Rabbit pAb (A24519)

Immunohistochemistry analysis of C1qa in paraffin-embedded Human tonsil tissue using C1qa Rabbit pAb (A24519) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - C1qa Rabbit pAb (A24519)

Immunofluorescence analysis of NIH/3T3 cells using C1qa Rabbit pAb (A24519) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using C1qa Rabbit pAb (A24519) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	C1qa Rabbit pAb
Catalog No.	A24519
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in several processes, including complement-mediated synapse pruning; microglial cell activation; and nervous system development. Acts upstream of or within complement activation, classical pathway. Located in postsynapse. Is expressed in brain; foot; genitourinary system; and pancreas. Used to study epilepsy and systemic lupus erythematosus. Human ortholog(s) of this gene implicated in glomerulonephritis. Orthologous to human C1QA (complement C1q A chain).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 23-245 of mouse C1qa (NP_031598.2).
Sequence	EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
Gene ID
Swiss Prot
Synonyms	C1q; Adic; C1qa
Calculated MW	26kDa
Observed MW	30kDa/

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:500 - 1:1000 IF/ICC 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse plasma, Rat plasma,
Cellular location