제품 > 항체 > 다중클론항체(pAb)

C3AR1 Rabbit pAb (A24665)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from Mouse heart, using C3AR1 Rabbit pAb (A24665) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	C3AR1 Rabbit pAb
Catalog No.	A24665
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

C3a is an anaphylatoxin released during activation of the complement system. The protein encoded by this gene is an orphan G protein-coupled receptor for C3a. Binding of C3a by the encoded receptor activates chemotaxis, granule enzyme release, superoxide anion production, and bacterial opsonization.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human C3AR1(NP_004045.1).
Sequence	MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPS
Gene ID
Swiss Prot
Synonyms	AZ3B; C3AR; HNFAG09; C3AR1
Calculated MW	54kDa
Observed MW	54kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse heart
Cellular location	Cell membrane, Multi-pass membrane protein
Customer validation	WB(Mus musculus)