제품 > 항체 > 다중클론항체(pAb)

CABP7 Rabbit pAb (A13703)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CABP7 Rabbit pAb (A13703) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - CABP7 Rabbit pAb (A13703)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using CABP7 Rabbit pAb (A13703) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human stomach using CABP7 Rabbit pAb (A13703) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse testis using CABP7 Rabbit pAb (A13703) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse kidney using CABP7 Rabbit pAb (A13703) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	CABP7 Rabbit pAb
Catalog No.	A13703
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable calcium ion binding activity. Located in trans-Golgi network membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human CABP7 (NP_872333.1).
Sequence	PKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI
Gene ID
Swiss Prot
Synonyms	CALN2; CABP7
Calculated MW	24kDa
Observed MW	30kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse brain, Mouse lung, Mouse kidney, Rat lung, Rat kidney
Cellular location	Cell membrane, Cytoplasm, Golgi apparatus, Single-pass type IV membrane protein, perinuclear region, trans-Golgi network membrane