제품 > 항체 > 다중클론항체(pAb)

CADPS Rabbit pAb (A17026)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunohistochemistry analysis of paraffin-embedded human breast cancer using CADPS Rabbit pAb (A17026) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human stomach using CADPS Rabbit pAb (A17026) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	CADPS Rabbit pAb
Catalog No.	A17026
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a novel neural/endocrine-specific cytosolic and peripheral membrane protein required for the Ca2+-regulated exocytosis of secretory vesicles. The protein acts at a stage in exocytosis that follows ATP-dependent priming, which involves the essential synthesis of phosphatidylinositol 4, 5-bisphosphate (PtdIns(4, 5)P2). Alternative splicing has been observed at this locus and three variants, encoding distinct isoforms, are described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1020-1100 of human CADPS (NP_899630.1).
Sequence	MASDMIESCVKRTRIAFEVKLQKTSRSTDFRVPQSICTMFNVMVDAKAQSTKLCSMEMGQEHQYHSKIDELIEETVKEMIT
Gene ID
Swiss Prot
Synonyms	CAPS; CAPS1; CADPS1; UNC-31; CADPS
Calculated MW	153kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Immunohistochemistry
Positive samples
Cellular location	Cell junction, Cytoplasmic side, Cytoplasmic vesicle membrane, Peripheral membrane protein, synapse