제품 > 항체 > 다중클론항체(pAb)

CALHM1 Rabbit pAb (A7858)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using CALHM1 Rabbit pAb (A7858) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - CALHM1 Rabbit pAb (A7858)

Immunohistochemistry analysis of paraffin-embedded Rat brain using CALHM1 Rabbit pAb (A7858) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	CALHM1 Rabbit pAb
Catalog No.	A7858
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a calcium channel that plays a role in processing of amyloid-beta precursor protein. A polymorphism at this locus has been reported to be associated with susceptibility to late-onset Alzheimer's disease in some populations, but the pathogenicity of this polymorphism is unclear.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 202-346 of human CALHM1 (NP_001001412.3).
Sequence	VRSVRPCFTQAAFLKSKYWSHYIDIERKLFDETCTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV
Gene ID
Swiss Prot
Synonyms	FAM26C; CALHM1
Calculated MW	38kDa
Observed MW	45kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	SH-SY5Y, HepG2, U-87MG
Cellular location	Cell membrane, Endoplasmic reticulum membrane, Multi-pass membrane protein