제품 > 항체 > 단일클론항체(mAb)

CAMP Rabbit mAb (A27271)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with CAMP using CAMP Rabbit mAb (A27271) at 1:12000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
.Exposure time: 10s.

ABclonal:Immunohistochemistry - CAMP Rabbit mAb (A27271)

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using CAMP Rabbit mAb (A27271) at a dilution of 1:6000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using CAMP Rabbit mAb (A27271) at a dilution of 1:6000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using CAMP Rabbit mAb (A27271) at a dilution of 1:6000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using CAMP Rabbit mAb (A27271) at a dilution of 1:6000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	CAMP Rabbit mAb
Catalog No.	A27271
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC69535

Background

This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. The protein plays an important role in innate immunity defense against viruses. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 71-170 of human CAMP (NP_004336.4).
Sequence	PDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Gene ID
Swiss Prot
Synonyms	LL37; CAP18; CRAMP; HSD26; CAP-18; FALL39; FALL-39
Calculated MW	19kDa
Observed MW	19kDa/14kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:12000 - 1:72000 IHC-P 1:5000 - 1:20000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T
Cellular location	cell projection, extracellular exosome, extracellular region, extracellular space, Secreted.