제품 > 항체 > 다중클론항체(pAb)

CAMP Rabbit pAb (A15653)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of lysates from THP-1 cells, using CAMP Rabbit pAb (A15653) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - CAMP Rabbit pAb (A15653)

Immunohistochemistry analysis of paraffin-embedded Rat bone marrow using CAMP Rabbit pAb (A15653) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human appendix using CAMP Rabbit pAb (A15653) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunofluorescence - CAMP Rabbit pAb (A15653)

Immunofluorescence analysis of paraffin-embedded rat bone marrow using CAMP Rabbit pAb (A15653) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	CAMP Rabbit pAb
Catalog No.	A15653
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. The protein plays an important role in innate immunity defense against viruses. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 132-170 of human CAMP (NP_004336.3).
Sequence	NKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR
Gene ID
Swiss Prot
Synonyms	LL37; CAP18; CRAMP; HSD26; CAP-18; FALL39; FALL-39; CAMP
Calculated MW	19kDa
Observed MW	18kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	THP-1
Cellular location	Secreted.
Customer validation	IF(Rattus norvegicus)