제품 > 항체 > 단일클론항체(mAb)

CAR/CXADR Rabbit mAb (A22607)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using CAR/CXADR Rabbit mAb (A22607) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunofluorescence - CAR/CXADR Rabbit mAb (A22607)

Confocal imaging of Hep G2 and K-562(negative sample) cells using CAR/CXADR Rabbit mAb (A22607, dilution 1:700)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	CAR/CXADR Rabbit mAb
Catalog No.	A22607
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC58170

Background

The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Several transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene are found on chromosomes 15, 18, and 21.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-237 of human CAR/CXADR. (NP_001329.1).
Sequence	LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAG
Gene ID
Swiss Prot
Synonyms	CAR; HCAR; CAR4/6; CAR/CXADR
Calculated MW	40kDa
Observed MW	40-50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:10000 IF/ICC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Hep G2, BxPC-3, mouse brain, mouse lung, rat lung, rat brain
Cellular location	Basolateral cell membrane, Cell junction, Cell membrane, Secreted, Single-pass membrane protein, Single-pass type I membrane protein, Single-pass type I membrane protein, adherens junction, tight junction