Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from 293F cells, using CCAR2/DBC1 Rabbit pAb (A24534) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of CCAR2/DBC1 in paraffin-embedded Human thyroid tissue using CCAR2/DBC1 Rabbit pAb (A24534) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of CCAR2/DBC1 in paraffin-embedded Mouse brain tissue using CCAR2/DBC1 Rabbit pAb (A24534) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of CCAR2/DBC1 in paraffin-embedded Rat brain tissue using CCAR2/DBC1 Rabbit pAb (A24534) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of CCAR2/DBC1 in paraffin-embedded Human liver cancer tissue using CCAR2/DBC1 Rabbit pAb (A24534) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Product name | CCAR2/DBC1 Rabbit pAb |
|---|---|
| Catalog No. | A24534 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CCAR2/DBC1 (NP_066997.3). |
|---|---|
| Sequence | MSQFKRQRINPLPGGRNFSGTASTSLLGPPPGLLTPPVATELSQNARHLQGGEKQRVFTGIVTSLHDYFGVVDEEVFFQLSVVKGRLPQLGEKVLVKAAY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CCAR2; DBC-1; DBC1; KIAA1967; NET35; p30 DBC; p30DBC; cell cycle and apoptosis regulator 2; CCAR2/DBC1 |
| Calculated MW | 102kDa/103kDa |
| Observed MW | 130kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | 293F |
| Cellular location | Cytoplasm, Nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
