Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CCKBR Rabbit pAb |
---|---|
Catalog No. | A14567 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 240-335 of human CCKBR (NP_795344.1). |
---|---|
Sequence | LISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRML |
Gene ID | |
Swiss Prot | |
Synonyms | GASR; CCK-B; CCK2R; CCKBR |
Calculated MW | 48kDa |
Observed MW | 48kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-549, HT-29, K-562, BxPC-3, Mouse brain, Rat brain |
Cellular location | Cell membrane, Multi-pass membrane protein |
Customer validation | WB(Rattus norvegicus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14567? Please let us know so that we can cite the reference in this datasheet.