제품 > 항체 > 다중클론항체(pAb)

CCL4 Rabbit pAb (A25848)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from RAW 264.7 cells using CCL4 Rabbit pAb (A25848) at 1:1000 dilution incubated overnight at 4℃. Raw264.7 cells were treated by PMA (80 nM) at 37℃ for overnight and LPS (1 μg/ml) at 37℃ for 6 hours and Brefeldin A for 3 hours of stimulation.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	CCL4 Rabbit pAb
Catalog No.	A25848
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable chemokine receptor binding activity and identical protein binding activity. Acts upstream of or within cellular response to xenobiotic stimulus. Located in extracellular space. Is expressed in central nervous system; genitourinary system; and retina. Human ortholog(s) of this gene implicated in acquired immunodeficiency syndrome and human immunodeficiency virus infectious disease. Orthologous to several human genes including CCL4L2 (C-C motif chemokine ligand 4 like 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-92 of mouse CCL4 (NP_038680.1).
Sequence	APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Gene ID
Swiss Prot
Synonyms	Act-2; Mip1b; Scya4; MIP-1B; AT744.1
Calculated MW	10kDa
Observed MW	12kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	RAW 264.7+PMA+LPS+BFA
Cellular location	Secreted