Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CCR1 Rabbit pAb |
---|---|
Catalog No. | A18341 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 255-354 of human CCR1 (NP_001286.1). |
---|---|
Sequence | YNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAG |
Gene ID | |
Swiss Prot | |
Synonyms | CKR1; CD191; CKR-1; HM145; CMKBR1; MIP1aR; SCYAR1; CCR1 |
Calculated MW | 41kDa |
Observed MW | 37kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | RPMI 8226 |
Cellular location | cytoplasm, external side of plasma membrane, plasma membrane |
Customer validation | WB(Homo sapiens, Mus musculus) IHC(Mus musculus, Rattus norvegicus) FC(Mus musculus) RT-PCR(Mus musculus) IF(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A18341? Please let us know so that we can cite the reference in this datasheet.