제품 > 항체 > 단일클론항체(mAb)

CD146/MCAM Rabbit mAb (A9703)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CD146/MCAM Rabbit mAb (A9703) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - CD146/MCAM Rabbit mAb (A9703)

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using CD146/MCAM Rabbit mAb (A9703) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	CD146/MCAM Rabbit mAb
Catalog No.	A9703
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1708

Background

Involved in glomerular filtration and vascular wound healing. Acts upstream of or within angiogenesis. Located in external side of plasma membrane. Biomarker of chronic obstructive pulmonary disease and uveal melanoma.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 547-646 of human CD146/MCAM (P43121).
Sequence	STERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH
Gene ID
Swiss Prot
Synonyms	CD146; MUC18; HEMCAM; METCAM; MelCAM; CD146/MCAM
Calculated MW	72kDa
Observed MW	120kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	A375, Mouse lung, Rat lung
Cellular location	Membrane, Single-pass type I membrane protein
Customer validation	WB(Homo sapiens)