제품 > 항체 > 단일클론항체(mAb)

CD147 Rabbit mAb (A21147)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of various lysates using CD147 Rabbit mAb (A21147) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 25s.

ABclonal:Immunohistochemistry - CD147 Rabbit mAb (A21147)

Immunohistochemistry analysis of paraffin-embedded mouse liver using CD147 Rabbit mAb (A21147) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse lung using CD147 Rabbit mAb (A21147) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse stomach using CD147 Rabbit mAb (A21147) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	CD147 Rabbit mAb
Catalog No.	A21147
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC3054

Background

Predicted to enable cell-cell adhesion mediator activity; signaling receptor activity; and virus receptor activity. Involved in neural retina development; photoreceptor cell maintenance; and spermatogenesis. Located in several cellular components, including acrosomal membrane; photoreceptor inner segment; and photoreceptor outer segment. Is expressed in several structures, including alimentary system; brain; early conceptus; reproductive system; and sensory organ. Orthologous to human BSG (basigin (Ok blood group)).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 141-302 of mouse CD147 (NP_033898.1).
Sequence	TIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGT
Gene ID
Swiss Prot
Synonyms	HT-7; CD147; EMMPRIN
Calculated MW	42kDa
Observed MW	38-58kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse lung, Mouse liver, Mouse heart
Cellular location	basolateral plasma membrane, endosome, mitochondrion, plasma membrane