제품 > 항체 > 단일클론항체(mAb)

CD150/SLAM Rabbit mAb (A24977)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 C2C12 cells (negative control, left) and mouse thymocytes (right) were surface-stained with CD150/SLAM Rabbit mAb (A24977, 2μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 mouse thymocytes were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or CD150/SLAM Rabbit mAb(A24977, 2 μg/mL, right).

Overview

Product name	CD150/SLAM Rabbit mAb
Catalog No.	A24977
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64802

Background

Enables identical protein binding activity and signaling receptor activity. Involved in natural killer cell activation; positive regulation of activated T cell proliferation; and regulation of cytokine production. Acts upstream of or within several processes, including leukocyte chemotaxis involved in inflammatory response; positive regulation of leukocyte chemotaxis; and regulation of vesicle fusion. Located in external side of plasma membrane and phagocytic vesicle. Is expressed in liver lobe. Orthologous to human SLAMF1 (signaling lymphocytic activation molecule family member 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 25-242 of mouse CD150/SLAM (NP_038758.2).
Sequence	TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSP
Gene ID
Swiss Prot
Synonyms	Slam; CD150; IPO-3; CDw150; ESTM51; 4933415F16; CD150/SLAM
Calculated MW	38kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane , Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD150/SLAM Rabbit mAb images

Flow CytoMetry - CD150/SLAM Rabbit mAb (A24977)

Flow cytometry: 1X10^6 mouse thymocytes were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or CD150/SLAM Rabbit mAb(A24977, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.