제품 > 항체 > 단일클론항체(mAb)

CD162/PSGL-1 Rabbit mAb (A25545)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using CD162/PSGL-1 Rabbit mAb (A25545) at 1:30000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): MCF7.
Exposure time: 30s.

ABclonal:Immunofluorescence - CD162/PSGL-1 Rabbit mAb (A25545)

Immunofluorescence analysis of U-937 cells using CD162/PSGL-1 Rabbit mAb (A25545) at a dilution of 1:150 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Jurkat cells using CD162/PSGL-1 Rabbit mAb (A25545) at a dilution of 1:150 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Flow CytoMetry - CD162/PSGL-1 Rabbit mAb (A25545)

Flow cytometry: 1X10^6 MCF7 cells (negative control, left) and Jurkat cells (right) were surface-stained with CD162/PSGL-1 Rabbit mAb (A25545, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Jurkat cells were surface-stainedwith Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD162/PSGL-1 Rabbit mAb (A25545, 2 μg/mL, right), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.

Overview

Product name	CD162/PSGL-1 Rabbit mAb
Catalog No.	A25545
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55292

Background

This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 42-295 of human CD162/PSGL-1 (NP_002997.2).
Sequence	QATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKG
Gene ID
Swiss Prot
Synonyms	CLA; CD162; PSGL1; PSGL-1; CD162/PSGL-1
Calculated MW	43KDa/45KDa
Observed MW	120kDa, 240kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:30000 - 1:120000 IF/ICC 1:100 - 1:1600 FC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Flow Cytometry
Positive samples	Jurkat
Cellular location	Membrane ; Single-pass type I membrane protein