Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | CD162/PSGL-1 Rabbit pAb |
---|---|
Catalog No. | A1660 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 348-412 of human CD162/PSGL-1 (NP_002997.2). |
---|---|
Sequence | KGHMYPVRNYSPTEMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP |
Gene ID | |
Swiss Prot | |
Synonyms | CLA; CD162; PSGL1; PSGL-1 |
Calculated MW | 43kDa |
Observed MW | 120kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Jurkat |
Cellular location | Membrane, Single-pass type I membrane protein |
Customer validation | WB(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1660? Please let us know so that we can cite the reference in this datasheet.