제품 > 항체 > 단일클론항체(mAb)

CD26/DPP4 Rabbit mAb (A4252)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using CD26/DPP4 Rabbit mAb (A4252) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

Overview

Product name	CD26/DPP4 Rabbit mAb
Catalog No.	A4252
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0939

Background

The DPP4 gene encodes dipeptidyl peptidase 4, which is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic type II transmembrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. Dipeptidyl peptidase 4 is highly involved in glucose and insulin metabolism, as well as in immune regulation. This protein was shown to be a functional receptor for Middle East respiratory syndrome coronavirus (MERS-CoV), and protein modeling suggests that it may play a similar role with SARS-CoV-2, the virus responsible for COVID-19.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 667-766 of human CD26/DPP4 (P27487).
Sequence	TERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP
Gene ID
Swiss Prot
Synonyms	CD26; ADABP; ADCP2; DPPIV; TP103
Calculated MW	88kDa
Observed MW	105kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse liver, Rat lung, Rat liver, Rat kidney
Cellular location	Apical cell membrane, Cell junction, Cell membrane, Cell projection, Membrane raft, Secreted, Single-pass type II membrane protein, invadopodium membrane, lamellipodium membrane
Customer validation	WB(Homo sapiens)