제품 > 항체 > 단일클론항체(mAb)

CD31/PECAM1 Rabbit mAb (A23691)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates, using CD31/PECAM1 Rabbit mAb (A23691) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Flow CytoMetry - CD31/PECAM1 Rabbit mAb (A23691)

Flow cytometry:1X10^6 NIH/3T3 cells(negative control, left) and C57BL/6 mouse Splenocytes (right) were surface-stained with CD31/PECAM1 Rabbit mAb(A23691, 2μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2μg/mL, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Rat Splenocytes were surface-stained with CD31/PECAM1 Rabbit mAb(A23691, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line), followed by FITC conjugated goat anti-rabbit pAb (1:200 dilution) staining.Non-fluorescently stained Rat Splenocytes were used as blank control (red line).

Flow cytometry:1X10^6 C57BL/6 mouse Splenocytes were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or CD31/PECAM1 Rabbit mAb(A23691, 2 μg/mL, right).

Flow cytometry:1X10^6 Rat Splenocytes were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or CD31/PECAM1 Rabbit mAb(A23691, 2 μg/mL, right).

Review

Overview

Product name	CD31/PECAM1 Rabbit mAb
Catalog No.	A23691
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61018

Background

Predicted to enable protein homodimerization activity; protein phosphatase binding activity; and transmembrane signaling receptor activity. Acts upstream of or within several processes, including Rho protein signal transduction; endothelial cell morphogenesis; and positive regulation of tyrosine phosphorylation of STAT protein. Located in several cellular components, including cell-cell contact zone; external side of plasma membrane; and smooth muscle contractile fiber. Is expressed in several structures, including alimentary system; cardiovascular system; central nervous system; extraembryonic component; and genitourinary system. Human ortholog(s) of this gene implicated in coronary artery disease (multiple); lung non-small cell carcinoma; neuroblastoma; and psoriatic arthritis. Orthologous to human PECAM1 (platelet and endothelial cell adhesion molecule 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 18-220 of mouse CD31/PECAM1(NP_001292086.1).
Sequence	ENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLM
Gene ID
Swiss Prot
Synonyms	Cd31; Pecam; PECAM-1; CD31/PECAM1
Calculated MW	81kDa
Observed MW	110-130kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 FC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Flow Cytometry
Positive samples	Mouse lung
Cellular location	Cell membrane, Membrane raft, Cell junction
Customer validation	(mouse intestinal tissue)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD31/PECAM1 Rabbit mAb images

Western blot - CD31/PECAM1 Rabbit mAb (A23691)

Flow CytoMetry - CD31/PECAM1 Rabbit mAb (A23691)

Flow cytometry:1X10^6 C57BL/6 mouse Splenocytes were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or CD31/PECAM1 Rabbit mAb(A23691, 2 μg/mL, right).

Flow CytoMetry - CD31/PECAM1 Rabbit mAb (A23691)

Flow cytometry:1X10^6 Rat Splenocytes were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or CD31/PECAM1 Rabbit mAb(A23691, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.