Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | CD32A + CD32B + CD32C Rabbit mAb |
---|---|
Catalog No. | A21073 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2905 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CD32A/CD32B/CD32C (NP_001129691.1/NP_001381406.1/NP_963857.3). |
---|---|
Sequence | MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSG |
Gene ID | |
Swiss Prot | |
Synonyms | CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1; FcgammaRIIa; CD32A + CD32B + CD32C |
Calculated MW | 35kDa/34kDa |
Observed MW | 25-50kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Raji, Daudi, K-562, U-937, THP-1, HL-60, HLE |
Cellular location | Golgi apparatus, plasma membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.