제품 > 항체 > 단일클론항체(mAb)

CD335/NKp46 Rabbit mAb (A25145)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293F cells transfected with CD335/NKp46 using CD335/NKp46 Rabbit mAb (A25145) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
.Exposure time: 30s.

ABclonal:Immunofluorescence - CD335/NKp46 Rabbit mAb (A25145)

Confocal imaging of 293F cells transfected with CD335/NKp46 using CD335/NKp46 Rabbit mAb (A25145, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - CD335/NKp46 Rabbit mAb (A25145)

Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with CD335/NKp46 Rabbit mAb (A25145, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or CD335/NKp46 Rabbit mAb (A25145, 2 μg/mL, right).

Overview

Product name	CD335/NKp46 Rabbit mAb
Catalog No.	A25145
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62449

Background

The natural cytotoxic receptor (NCR) family includes NCR1 (NKp46/CD335), NCR2 (NKp44/CD336), and NCR3 (NKp30/CD337). They are type I single Transmembrane protein belonging to the immunoglobulin (Ig) superfamily. Various pathogenic and host coding molecules have been identified as ligands for NCR. They were initially discovered through their ability to induce cytotoxicity of natural killer (NK) cells to tumor cells in vitro, and animal models have shown that NCR plays a role in tumor monitoring, viral infection, and pregnancy in vivo. NCR1/NKP46 is considered a universal marker of NK cells, and recent studies have found that it is also expressed by other cells, such as the first group of natural lymphocytes (ILC1), a subgroup of the third group of ILC (NCR+ILC3), and γδ T cells. NCR1/NKp46 is also expressed in some malignant NK cells, natural killer T (NKT) cells and T-cell lymphoma, and is considered as a diagnostic marker and therapeutic target for them. The cross-linking of NCR1/NKp46 with antibodies can activate NK cells, which has been studied as a promising therapeutic pathway.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-254 of human CD335/NKp46(NP_004820.2).
Sequence	QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQ
Gene ID
Swiss Prot
Synonyms	NCR1; CD335; LY94; NK-p46; NKP46; natural cytotoxicity triggering receptor 1
Calculated MW	21kDa/22kDa/23kDa/32kDa/34kDa
Observed MW	35-40kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500-1:1000 IF/ICC 1:50-1:200 FC 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Flow Cytometry
Positive samples	293F cells transfected with CD335/NKp46
Cellular location	Cell membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구면역학 & 염증CDs

CD335/NKp46 Rabbit mAb images

Western blot - CD335/NKp46 Rabbit mAb (A25145)

Immunofluorescence - CD335/NKp46 Rabbit mAb (A25145)

Flow CytoMetry - CD335/NKp46 Rabbit mAb (A25145)

Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or CD335/NKp46 Rabbit mAb (A25145, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.