제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human CD335/NKp46 mAb (A26605)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with PE Rabbit anti-Human CD335/NKp46 mAb (A26605, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD335/NKp46 mAb (A26605, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 450 Mouse anti-Human CD56 mAb (5 μl/Test) and PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD335/NKp46 mAb (A26605, 5 μl/Test, right).Cells in the lymphocytes gate were used for analysis.

Overview

Product name	PE Rabbit anti-Human CD335/NKp46 mAb
Catalog No.	A26605
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62449-PE

Background

Predicted to be involved in cellular defense response; regulation of natural killer cell mediated cytotoxicity; and signal transduction. Predicted to act upstream of or within defense response to virus and detection of virus. Predicted to be located in cell surface. Predicted to be part of SWI/SNF complex. Predicted to be active in plasma membrane. Biomarker of acquired immunodeficiency syndrome; anogenital venereal wart; hepatitis C; and lymphoproliferative syndrome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-254 of human CD335/NKp46 (NP_004820.2).
Sequence	QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQ
Gene ID
Swiss Prot
Synonyms	LY94; CD335; NKP46; NK-p46
Calculated MW	21kDa/22kDa/23kDa/32kDa/34kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein.