제품 > 항체 > 단일클론항체(mAb)

CD39/ENTPD1 Rabbit mAb (A25085)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with CD39/ENTPD1 Rabbit mAb (A25085, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line), followed by FITC conjugated goat anti-Rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or CD39/ENTPD1 Rabbit mAb (A25085, 2 μg/mL, right).

ABclonal:Western blot - CD39/ENTPD1 Rabbit mAb (A25085)

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with CD39/ENTPD1 using CD39/ENTPD1 Rabbit mAb(A25085) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	CD39/ENTPD1 Rabbit mAb
Catalog No.	A25085
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64460

Background

The protein encoded by this gene is a plasma membrane protein that hydrolyzes extracellular ATP and ADP to AMP. Inhibition of this protein's activity may confer anticancer benefits. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 255-442 of human CD39/ENTPD1 (NP_001767.3).
Sequence	CYGKDQALWQKLAKDIQVASNEILRDPCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGK
Gene ID
Swiss Prot
Synonyms	CD39; SPG64; ATPDase; NTPDase-1; CD39/ENTPD1
Calculated MW	58kDa
Observed MW	60kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Flow Cytometry
Positive samples	293T transfected with CD39/ENTPD1(Human)
Cellular location	Membrane, Multi-pass membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구면역학 & 염증CDs

CD39/ENTPD1 Rabbit mAb images

Flow CytoMetry - CD39/ENTPD1 Rabbit mAb (A25085)

Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or CD39/ENTPD1 Rabbit mAb (A25085, 2 μg/mL, right).

Western blot - CD39/ENTPD1 Rabbit mAb (A25085)

* For research use only. Not for therapeutic or diagnostic purposes.