제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human CD39/ENTPD1 mAb (A26520)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Human PBMC were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD39/ENTPD1 mAb (A26520, 5 μl/Test, right). Cells in the lymphocytes gate were used for analysis.

Flow cytometry:1X10^6 Human PBMC were surface-stained with FITC Mouse anti-Human CD19 mAb (A22815, 5 μl/Test) and PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD39/ENTPD1 mAb (A26520, 5 μl/Test, right). Cells in the lymphocytes gate were used for analysis.

Overview

Product name	PE Rabbit anti-Human CD39/ENTPD1 mAb
Catalog No.	A26520
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64460-PE

Background

The protein encoded by this gene is a plasma membrane protein that hydrolyzes extracellular ATP and ADP to AMP. Inhibition of this protein's activity may confer anticancer benefits. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 255-442 of human CD39/ENTPD1 (NP_001767.3) .
Sequence	CYGKDQALWQKLAKDIQVASNEILRDPCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGK
Gene ID
Swiss Prot
Synonyms	CD39; SPG64; ATPDase; NTPDase-1
Calculated MW	34kDa/42kDa/46kDa/57kDa/58kDa/59kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Multi-pass membrane protein.