제품 > 항체 > 단일클론항체(mAb)

CD3D Rabbit mAb (A9770)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Jurkat cells, using CD3D Rabbit mAb (A9770) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - CD3D Rabbit mAb (A9770)

Confocal imaging of paraffin-embedded Human spleen tissue using CD3D Rabbit mAb (A9770, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Flow CytoMetry - CD3D Rabbit mAb (A9770)

Flow cytometry: 1X10^6 Raji cells (negative control, left) and Jurkat cells (right) were surface-stained with CD3D Rabbit mAb (A9770, 2.5 μg/mL orange line) or ABflo® 488 IgG isotype control (AC042, 2.5 μg/mL, blue line). Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	CD3D Rabbit mAb
Catalog No.	A9770
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1741

Background

The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 72-171 of human CD3D (P04234).
Sequence	RCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Gene ID
Swiss Prot
Synonyms	T3D; IMD19; CD3DELTA; CD3-DELTA; CD3D
Calculated MW	19kDa
Observed MW	23kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:200 - 1:800 FC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Flow Cytometry
Positive samples	Jurkat
Cellular location	Membrane, Single-pass type I membrane protein.
Customer validation	WB(Homo sapiens) IP(Homo sapiens) IHC(Homo sapiens)